Recombinant Human CD99L2, His-tagged
| Cat.No. : | CD99L2-61H |
| Product Overview : | Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-Ala188) of Human CD99L2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 26-188 a.a. |
| Description : | CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. |
| AA Sequence : | DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIG GRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVG GGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | CD99L2 CD99 molecule-like 2 [ Homo sapiens ] |
| Official Symbol | CD99L2 |
| Synonyms | CD99L2; CD99 molecule-like 2; CD99 antigen like 2 , MIC2 like 1 , MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024; |
| Gene ID | 83692 |
| mRNA Refseq | NM_001184808 |
| Protein Refseq | NP_001171737 |
| MIM | 300846 |
| UniProt ID | Q8TCZ2 |
| Chromosome Location | Xq28 |
| ◆ Recombinant Proteins | ||
| Cd99l2-3263M | Recombinant Mouse Cd99l2 protein(Met1-Ala164), hFc-tagged | +Inquiry |
| CD99L2-9720Z | Recombinant Zebrafish CD99L2 | +Inquiry |
| CD99L2-3127H | Recombinant Human CD99L2 Protein, MYC/DDK-tagged | +Inquiry |
| RFL35148BF | Recombinant Full Length Bovine Cd99 Antigen-Like Protein 2(Cd99L2) Protein, His-Tagged | +Inquiry |
| CD99L2-1268R | Recombinant Rat CD99L2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD99L2-2222MCL | Recombinant Mouse CD99L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD99L2 Products
Required fields are marked with *
My Review for All CD99L2 Products
Required fields are marked with *
