Recombinant Human CD99L2, His-tagged
Cat.No. : | CD99L2-61H |
Product Overview : | Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-Ala188) of Human CD99L2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-188 a.a. |
Description : | CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. |
AA Sequence : | DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIG GRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVG GGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CD99L2 CD99 molecule-like 2 [ Homo sapiens ] |
Official Symbol | CD99L2 |
Synonyms | CD99L2; CD99 molecule-like 2; CD99 antigen like 2 , MIC2 like 1 , MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024; |
Gene ID | 83692 |
mRNA Refseq | NM_001184808 |
Protein Refseq | NP_001171737 |
MIM | 300846 |
UniProt ID | Q8TCZ2 |
Chromosome Location | Xq28 |
◆ Recombinant Proteins | ||
CD99L2-5203H | Recombinant Human CD99L2 Protein (Met1-Gly185), C-His tagged | +Inquiry |
Cd99l2-815M | Active Recombinant Mouse Cd99l2 Protein, Fc Chimera | +Inquiry |
CD99L2-779H | Active Recombinant Human CD99L2 Protein, Fc Chimera | +Inquiry |
CD99L2-3107HF | Recombinant Full Length Human CD99L2 Protein, GST-tagged | +Inquiry |
RFL4113XF | Recombinant Full Length Xenopus Tropicalis Cd99 Antigen-Like Protein 2(Cd99L2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD99L2-2222MCL | Recombinant Mouse CD99L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD99L2 Products
Required fields are marked with *
My Review for All CD99L2 Products
Required fields are marked with *