Recombinant Human CD99L2, His-tagged

Cat.No. : CD99L2-61H
Product Overview : Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-Ala188) of Human CD99L2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-188 a.a.
Description : CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
AA Sequence : DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIG GRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVG GGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CD99L2 CD99 molecule-like 2 [ Homo sapiens ]
Official Symbol CD99L2
Synonyms CD99L2; CD99 molecule-like 2; CD99 antigen like 2 , MIC2 like 1 , MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024;
Gene ID 83692
mRNA Refseq NM_001184808
Protein Refseq NP_001171737
MIM 300846
UniProt ID Q8TCZ2
Chromosome Location Xq28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD99L2 Products

Required fields are marked with *

My Review for All CD99L2 Products

Required fields are marked with *

0
cart-icon