Recombinant Human CD99L2 Protein, GST-Tagged

• Cat.No.: CD99L2-0893H
• Product Overview: Human CD99L2 full-length ORF (AAH25729.1, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Molecular Mass: 42.1 kDa
• AA Sequence: MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD99L2 CD99 molecule-like 2 [ Homo sapiens ]
• Official Symbol: CD99L2
• Synonyms: CD99L2; CD99 molecule-like 2; CD99 antigen like 2, MIC2 like 1, MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024
• Gene ID: 83692
• mRNA Refseq: NM_001184808
• Protein Refseq: NP_001171737
• MIM: 300846
• UniProt ID: Q8TCZ2