Recombinant Human CD99L2 Protein, GST-Tagged

Cat.No. : CD99L2-0893H
Product Overview : Human CD99L2 full-length ORF (AAH25729.1, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Molecular Mass : 42.1 kDa
AA Sequence : MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD99L2 CD99 molecule-like 2 [ Homo sapiens ]
Official Symbol CD99L2
Synonyms CD99L2; CD99 molecule-like 2; CD99 antigen like 2, MIC2 like 1, MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024;
Gene ID 83692
mRNA Refseq NM_001184808
Protein Refseq NP_001171737
MIM 300846
UniProt ID Q8TCZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD99L2 Products

Required fields are marked with *

My Review for All CD99L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon