Recombinant Human CDA, His-tagged

Cat.No. : CDA-26955TH
Product Overview : Recombinant full length Human CDA with an N terminal His tag; 166aa, 18.3kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 146 amino acids
Description : This gene encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias.
Conjugation : HIS
Molecular Weight : 18.300kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 40% Glycerol, 20mM Tris HCl, 2mM EDTA, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ
Gene Name CDA cytidine deaminase [ Homo sapiens ]
Official Symbol CDA
Synonyms CDA; cytidine deaminase; CDD;
Gene ID 978
mRNA Refseq NM_001785
Protein Refseq NP_001776
MIM 123920
Uniprot ID P32320
Chromosome Location 1p36.2-p35
Pathway Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function cytidine deaminase activity; cytidine deaminase activity; hydrolase activity; metal ion binding; nucleoside binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDA Products

Required fields are marked with *

My Review for All CDA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon