Recombinant Human CDA protein, His-tagged
Cat.No. : | CDA-3132H |
Product Overview : | Recombinant Human CDA protein(42-146 aa), fused to His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 42-146 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDA cytidine deaminase [ Homo sapiens ] |
Official Symbol | CDA |
Synonyms | CDA; cytidine deaminase; CDD; cytidine aminohydrolase; small cytidine deaminase; cytosine nucleoside deaminase; |
Gene ID | 978 |
mRNA Refseq | NM_001785 |
Protein Refseq | NP_001776 |
MIM | 123920 |
UniProt ID | P32320 |
◆ Recombinant Proteins | ||
CDA-9381H | Recombinant Human CDA protein, His&Myc-tagged | +Inquiry |
CDA-11703Z | Recombinant Zebrafish CDA | +Inquiry |
CDA-317HCL | Recombinant Human CDA Over-ex<x>pression Lysate | +Inquiry |
CDA-0894H | Recombinant Human CDA Protein, GST-Tagged | +Inquiry |
CDA-1079H | Recombinant Human CDA Protein (Ala2-Gln146), His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDA Products
Required fields are marked with *
My Review for All CDA Products
Required fields are marked with *