Recombinant Human CDA protein, T7/His-tagged
Cat.No. : | CDA-206H |
Product Overview : | Recombinant human CDA cDNA (145 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEG RIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDG TYIVMTVQELLPSSFGPEDLQKTQ |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | CDA cytidine deaminase [ Homo sapiens ] |
Official Symbol | CDA |
Synonyms | CDA; cytidine deaminase; CDD; cytidine aminohydrolase; small cytidine deaminase; cytosine nucleoside deaminase; |
Gene ID | 978 |
mRNA Refseq | NM_001785 |
Protein Refseq | NP_001776 |
MIM | 123920 |
UniProt ID | P32320 |
Chromosome Location | 1p36.2-p35 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; |
Function | cytidine deaminase activity; cytidine deaminase activity; hydrolase activity; metal ion binding; nucleoside binding; protein homodimerization activity; zinc ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
CDA-3925C | Recombinant Chicken CDA | +Inquiry |
CDA-3132H | Recombinant Human CDA protein, His-tagged | +Inquiry |
CDA-3108HF | Recombinant Full Length Human CDA Protein, GST-tagged | +Inquiry |
CDA-796H | Recombinant Human Cytidine Deaminase, His-tagged | +Inquiry |
CDA-598H | Recombinant Human CDA Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDA Products
Required fields are marked with *
My Review for All CDA Products
Required fields are marked with *