Recombinant Human CDA protein, T7/His-tagged

Cat.No. : CDA-206H
Product Overview : Recombinant human CDA cDNA (145 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEG RIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDG TYIVMTVQELLPSSFGPEDLQKTQ
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name CDA cytidine deaminase [ Homo sapiens ]
Official Symbol CDA
Synonyms CDA; cytidine deaminase; CDD; cytidine aminohydrolase; small cytidine deaminase; cytosine nucleoside deaminase;
Gene ID 978
mRNA Refseq NM_001785
Protein Refseq NP_001776
MIM 123920
UniProt ID P32320
Chromosome Location 1p36.2-p35
Pathway Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem;
Function cytidine deaminase activity; cytidine deaminase activity; hydrolase activity; metal ion binding; nucleoside binding; protein homodimerization activity; zinc ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDA Products

Required fields are marked with *

My Review for All CDA Products

Required fields are marked with *

0
cart-icon