"CDC16" Related Products

Expand
Expand

Recombinant Human CDC16 Protein, GST-Tagged

Cat.No. : CDC16-0902H
Product Overview : Human CDC16 full-length ORF (AAH17244, 1 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 93.83 kDa
AA Sequence : MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CDC16 cell division cycle 16 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : CDC16
Synonyms : CDC16; cell division cycle 16 homolog (S. cerevisiae); CDC16 (cell division cycle 16, S. cerevisiae, homolog), CDC16 cell division cycle 16 homolog (S. cerevisiae); cell division cycle protein 16 homolog; ANAPC6; anaphase promoting complex; subunit 6; APC6; CUT9; CDC16Hs; cyclosome subunit 6; anaphase-promoting complex subunit 6; anaphase-promoting complex, subunit 6;
Gene ID : 8881
mRNA Refseq : NM_001078645
Protein Refseq : NP_001072113
MIM : 603461
UniProt ID : Q13042

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.