Recombinant Human CDC25C Protein, GST-Tagged
Cat.No. : | CDC25C-0918H |
Product Overview : | Human CDC25C full-length ORF (AAH19089.1, 1 a.a. - 473 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 79.7 kDa |
AA Sequence : | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC25C cell division cycle 25 homolog C (S. pombe) [ Homo sapiens ] |
Official Symbol | CDC25C |
Synonyms | CDC25C; cell division cycle 25 homolog C (S. pombe); CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25C; M-phase inducer phosphatase 3; PPP1R60; protein phosphatase 1; regulatory subunit 60; mitosis inducer CDC25; cell division cycle 25C; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60; CDC25; |
Gene ID | 995 |
mRNA Refseq | NM_001790 |
Protein Refseq | NP_001781 |
MIM | 157680 |
UniProt ID | P30307 |
◆ Recombinant Proteins | ||
CDC25C-3054HF | Recombinant Full Length Human CDC25C Protein, GST-tagged | +Inquiry |
CDC25C-699H | Recombinant Human Cell Division Cycle 25 Homolog C (S. Pombe) | +Inquiry |
Cdc25c-853M | Recombinant Mouse Cdc25c Protein, MYC/DDK-tagged | +Inquiry |
CDC25C-11001H | Recombinant Human CDC25C, His-tagged | +Inquiry |
CDC25C-3133M | Recombinant Mouse CDC25C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC25C-7664HCL | Recombinant Human CDC25C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC25C Products
Required fields are marked with *
My Review for All CDC25C Products
Required fields are marked with *
0
Inquiry Basket