Recombinant Human CDC26, His-tagged
Cat.No. : | CDC26-27901TH |
Product Overview : | Recombinant full length Human Cdc26 / Apc12 with an N terminal His tag; 105 amino acids with tag, MWt 11.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 85 amino acids |
Description : | The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. |
Conjugation : | HIS |
Molecular Weight : | 11.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF |
Gene Name | CDC26 cell division cycle 26 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC26 |
Synonyms | CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26 , chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promo |
Gene ID | 246184 |
mRNA Refseq | NM_139286 |
Protein Refseq | NP_644815 |
Uniprot ID | Q8NHZ8 |
Chromosome Location | 9q32 |
Pathway | APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
CDC26-1678H | Recombinant Human Cell Division Cycle 26 Homolog (S. cerevisiae), His-tagged | +Inquiry |
CDC26-1273R | Recombinant Rat CDC26 Protein | +Inquiry |
CDC26-5672C | Recombinant Chicken CDC26 | +Inquiry |
CDC26-4328H | Recombinant Human CDC26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cdc26-2073M | Recombinant Mouse Cdc26 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC26-7663HCL | Recombinant Human CDC26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC26 Products
Required fields are marked with *
My Review for All CDC26 Products
Required fields are marked with *