Recombinant Human CDC26, His-tagged

Cat.No. : CDC26-27901TH
Product Overview : Recombinant full length Human Cdc26 / Apc12 with an N terminal His tag; 105 amino acids with tag, MWt 11.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 85 amino acids
Description : The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
Conjugation : HIS
Molecular Weight : 11.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Gene Name CDC26 cell division cycle 26 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CDC26
Synonyms CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26 , chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promo
Gene ID 246184
mRNA Refseq NM_139286
Protein Refseq NP_644815
Uniprot ID Q8NHZ8
Chromosome Location 9q32
Pathway APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC26 Products

Required fields are marked with *

My Review for All CDC26 Products

Required fields are marked with *

0
cart-icon