"CDC37" Related Products

Expand
Expand
Expand

Recombinant Human CDC37 protein, T7/His-tagged

Cat.No. : CDC37-124H
Product Overview : Recombinant human CDC37 (377aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEK EELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKD GFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDL EVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIE KAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK ASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name : CDC37 cell division cycle 37 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : CDC37
Synonyms : CDC37; cell division cycle 37 homolog (S. cerevisiae); CDC37 (cell division cycle 37, S. cerevisiae, homolog) , CDC37 cell division cycle 37 homolog (S. cerevisiae); hsp90 co-chaperone Cdc37; CDC37 (cell division cycle 37; S. cerevisiae; homolog); CDC37 cell division cycle 37 homolog; Hsp90 co chaperone Cdc37; P50CDC37; hsp90 chaperone protein kinase-targeting subunit; CDC37 (cell division cycle 37, S. cerevisiae, homolog);
Gene ID : 11140
mRNA Refseq : NM_007065
Protein Refseq : NP_008996
MIM : 605065
UniProt ID : Q16543
Chromosome Location : 19p13.2
Pathway : Androgen Receptor Signaling Pathway, organism-specific biosystem; Disease, organism-specific biosystem; LKB1 signaling events, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by EGFR in Cancer, organism-specific biosystem; Signaling by ERBB2, organism-specific biosystem; Signaling by constitutively active EGFR, organism-specific biosystem;
Function : Hsp90 protein binding; heat shock protein binding; protein binding; protein kinase binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.