"CDC37" Related Products

Expand
Expand
Expand

Recombinant Human CDC37 protein, T7/His-tagged

Cat.No.: CDC37-124H
Product Overview: Recombinant human CDC37 (377aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEK EELDRGCRECKRKVAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKD GFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDL EVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIE KAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK ASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CDC37 cell division cycle 37 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: CDC37
Synonyms: CDC37; cell division cycle 37 homolog (S. cerevisiae); CDC37 (cell division cycle 37, S. cerevisiae, homolog) , CDC37 cell division cycle 37 homolog (S. cerevisiae); hsp90 co-chaperone Cdc37; CDC37 (cell division cycle 37; S. cerevisiae; homolog); CDC37 cell division cycle 37 homolog; Hsp90 co chaperone Cdc37; P50CDC37; hsp90 chaperone protein kinase-targeting subunit; CDC37 (cell division cycle 37, S. cerevisiae, homolog);
Gene ID: 11140
mRNA Refseq: NM_007065
Protein Refseq: NP_008996
MIM: 605065
UniProt ID: Q16543
Chromosome Location: 19p13.2
Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Disease, organism-specific biosystem; LKB1 signaling events, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by EGFR in Cancer, organism-specific biosystem; Signaling by ERBB2, organism-specific biosystem; Signaling by constitutively active EGFR, organism-specific biosystem;
Function: Hsp90 protein binding; heat shock protein binding; protein binding; protein kinase binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.