Recombinant Human CDC40 Protein, GST-Tagged
Cat.No. : | CDC40-0932H |
Product Overview : | Human CDC40 full-length ORF (NP_056975.1, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 91.9 kDa |
AA Sequence : | MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC40 cell division cycle 40 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC40 |
Synonyms | EHB3; PRP17; PRPF17 |
Gene ID | 51362 |
mRNA Refseq | NM_015891 |
Protein Refseq | NP_056975 |
MIM | 605585 |
UniProt ID | O60508 |
◆ Recombinant Proteins | ||
CDC40-0932H | Recombinant Human CDC40 Protein, GST-Tagged | +Inquiry |
CDC40-1992Z | Recombinant Zebrafish CDC40 | +Inquiry |
CDC40-588R | Recombinant Rhesus Macaque CDC40 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC40-3138M | Recombinant Mouse CDC40 Protein | +Inquiry |
CDC40-762R | Recombinant Rhesus monkey CDC40 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC40-7658HCL | Recombinant Human CDC40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC40 Products
Required fields are marked with *
My Review for All CDC40 Products
Required fields are marked with *