Recombinant Human CDC42EP1, His-tagged
| Cat.No. : | CDC42EP1-26804TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 283-391 a.a. |
| Description : | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. |
| Conjugation : | HIS |
| Tissue specificity : | Endothelial and bone marrow stromal cells. |
| Form : | Lyophilised:Reconstitute with 112 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
| Sequence Similarities : | Belongs to the BORG/CEP family.Contains 1 CRIB domain. |
| Gene Name | CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ] |
| Official Symbol | CDC42EP1 |
| Synonyms | CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein; |
| Gene ID | 11135 |
| mRNA Refseq | NM_152243 |
| Protein Refseq | NP_689449 |
| MIM | 606084 |
| Uniprot ID | Q00587 |
| Chromosome Location | 22q13.1 |
| Function | protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42EP1 Products
Required fields are marked with *
My Review for All CDC42EP1 Products
Required fields are marked with *
