Recombinant Human CDC42EP1, His-tagged
Cat.No. : | CDC42EP1-26804TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 283-391 a.a. |
Description : | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. |
Conjugation : | HIS |
Tissue specificity : | Endothelial and bone marrow stromal cells. |
Form : | Lyophilised:Reconstitute with 112 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
Sequence Similarities : | Belongs to the BORG/CEP family.Contains 1 CRIB domain. |
Gene Name | CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ] |
Official Symbol | CDC42EP1 |
Synonyms | CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein; |
Gene ID | 11135 |
mRNA Refseq | NM_152243 |
Protein Refseq | NP_689449 |
MIM | 606084 |
Uniprot ID | Q00587 |
Chromosome Location | 22q13.1 |
Function | protein binding; |
◆ Recombinant Proteins | ||
CDC42EP1-1280R | Recombinant Rat CDC42EP1 Protein | +Inquiry |
CDC42EP1-938R | Recombinant Rat CDC42EP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42EP1-3102HF | Recombinant Full Length Human CDC42EP1 Protein, GST-tagged | +Inquiry |
Cdc42ep1-262M | Recombinant Mouse Cdc42ep1 Protein, MYC/DDK-tagged | +Inquiry |
CDC42EP1-0944H | Recombinant Human CDC42EP1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC42EP1-322HCL | Recombinant Human CDC42EP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC42EP1 Products
Required fields are marked with *
My Review for All CDC42EP1 Products
Required fields are marked with *
0
Inquiry Basket