Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CDC42EP1, His-tagged

Cat.No. : CDC42EP1-26804TH
Product Overview : Recombinant fragment, corresponding to amino acids 283-391 of Human CDC42EP1 with N terminal His tag; 109 amino acids, 51kDa.
  • Specification
  • Gene Information
  • Related Products
Description : CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow.
Conjugation : HIS
Source : E. coli
Tissue specificity : Endothelial and bone marrow stromal cells.
Form : Lyophilised:Reconstitute with 112 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWG AGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA PQAGSRTPVPSTVQANTFEFADAEEDDEVKV
Sequence Similarities : Belongs to the BORG/CEP family.Contains 1 CRIB domain.
Gene Name : CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ]
Official Symbol : CDC42EP1
Synonyms : CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein;
Gene ID : 11135
mRNA Refseq : NM_152243
Protein Refseq : NP_689449
MIM : 606084
Uniprot ID : Q00587
Chromosome Location : 22q13.1
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends