Recombinant Human CDC7 Protein, GST-Tagged

Cat.No. : CDC7-0957H
Product Overview : Human CDC7 partial ORF (NP_003494, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associated with neoplastic transformation for some tumors. Multiple alternatively spliced transcript variants that encode the same protein have been detected. [provided by RefSeq, Aug 2008]
Molecular Mass : 36.63 kDa
AA Sequence : QGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC7 cell division cycle 7 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol CDC7
Synonyms CDC7; cell division cycle 7 homolog (S. cerevisiae); CDC7 (cell division cycle 7, S. cerevisiae, homolog) like 1, CDC7 cell division cycle 7 (S. cerevisiae), CDC7L1, cell division cycle 7 (S. cerevisiae); cell division cycle 7-related protein kinase; HsCdc7; Hsk1; huCdc7; CDC7-related kinase; cell division cycle 7-like protein 1; CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1; CDC7L1; HsCDC7; huCDC7; MGC117361; MGC126237; MGC126238;
Gene ID 8317
mRNA Refseq NM_001134419
Protein Refseq NP_001127891
MIM 603311
UniProt ID O00311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC7 Products

Required fields are marked with *

My Review for All CDC7 Products

Required fields are marked with *

0
cart-icon