Recombinant Human CISD1 protein, His-tagged
| Cat.No. : | CISD1-7153H |
| Product Overview : | Recombinant Human CISD1 protein(1-108 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-108 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CISD1 CDGSH iron sulfur domain 1 [ Homo sapiens ] |
| Official Symbol | CISD1 |
| Synonyms | CISD1; CDGSH iron sulfur domain 1; C10orf70, chromosome 10 open reading frame 70 , ZCD1, zinc finger, CDGSH type domain 1; CDGSH iron-sulfur domain-containing protein 1; MDS029; mitoNEET; zinc finger CDGSH-type domain 1; zinc finger, CDGSH-type domain 1; CDGSH iron sulfur domain-containing protein 1; ZCD1; C10orf70; MGC14684; |
| Gene ID | 55847 |
| mRNA Refseq | NM_018464 |
| Protein Refseq | NP_060934 |
| MIM | 611932 |
| UniProt ID | Q9NZ45 |
| ◆ Recombinant Proteins | ||
| CISD1-3481M | Recombinant Mouse CISD1 Protein | +Inquiry |
| CISD1-7153H | Recombinant Human CISD1 protein, His-tagged | +Inquiry |
| CISD1-1074R | Recombinant Rat CISD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL25516RF | Recombinant Full Length Rat Cdgsh Iron-Sulfur Domain-Containing Protein 1(Cisd1) Protein, His-Tagged | +Inquiry |
| CISD1-707R | Recombinant Rhesus Macaque CISD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CISD1-7490HCL | Recombinant Human CISD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CISD1 Products
Required fields are marked with *
My Review for All CISD1 Products
Required fields are marked with *
