"CDH13" Related Products

Expand
Expand
Expand

Recombinant Human CDH13 protein, T7/His-tagged

Cat.No.: CDH13-31H
Product Overview: Recombinant human CDH13 extracellular domain (139-693 aa) fused with 31 N-terminal T7/His tag was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQ EPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEG SPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIE AQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNP GQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPM MVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLA IDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVW KISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAG
Purity: >90% by SDS-PAGE
Applications: 1. Protein can be used as coating matrix protein for study human neuronal and vascular endothelial cell / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for human neuronal axon connection study in vitro.
Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CDH13 cadherin 13, H-cadherin (heart) [ Homo sapiens ]
Official Symbol: CDH13
Synonyms: CDH13; cadherin 13, H-cadherin (heart); cadherin-13; CDHH; T cadherin; T-cad; H-cadherin; T-cadherin; heart cadherin; P105;
Gene ID: 1012
mRNA Refseq: NM_001220488
Protein Refseq: NP_001207417
MIM: 601364
UniProt ID: P55290
Chromosome Location: 16q23.3
Pathway: Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function: adiponectin binding; cadherin binding; calcium ion binding; lipoprotein particle binding; low-density lipoprotein particle binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.