Recombinant Human CDH13 protein, T7/His-tagged
| Cat.No. : | CDH13-31H |
| Product Overview : | Recombinant human CDH13 extracellular domain (139-693 aa) fused with 31 N-terminal T7/His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 139-693 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQ EPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEG SPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIE AQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNP GQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPM MVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLA IDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVW KISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAG |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein can be used as coating matrix protein for study human neuronal and vascular endothelial cell / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for human neuronal axon connection study in vitro. |
| Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CDH13 cadherin 13, H-cadherin (heart) [ Homo sapiens ] |
| Official Symbol | CDH13 |
| Synonyms | CDH13; cadherin 13, H-cadherin (heart); cadherin-13; CDHH; T cadherin; T-cad; H-cadherin; T-cadherin; heart cadherin; P105; |
| Gene ID | 1012 |
| mRNA Refseq | NM_001220488 |
| Protein Refseq | NP_001207417 |
| MIM | 601364 |
| UniProt ID | P55290 |
| Chromosome Location | 16q23.3 |
| Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
| Function | adiponectin binding; cadherin binding; calcium ion binding; lipoprotein particle binding; low-density lipoprotein particle binding; |
| ◆ Recombinant Proteins | ||
| Cdh13-992M | Recombinant Mouse Cdh13 Protein, His-tagged | +Inquiry |
| Cdh13-27R | Recombinant Rat Cdh13, LEVLFQ tagged | +Inquiry |
| Cdh13-25R | Recombinant Rat Cdh13, Fc tagged | +Inquiry |
| Cdh13-721M | Active Recombinant Mouse Cdh13 Protein, His-tagged | +Inquiry |
| Cdh13-991M | Recombinant Rat Cdh13 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH13-802RCL | Recombinant Rat CDH13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH13 Products
Required fields are marked with *
My Review for All CDH13 Products
Required fields are marked with *




