Recombinant Human CDH19 protein, His-tagged
| Cat.No. : | CDH19-3719H |
| Product Overview : | Recombinant Human CDH19 protein(1-390 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-390 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MNTTSHHIGQLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNGTITTSNSLDREISAWYNLSITATEK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CDH19 cadherin 19, type 2 [ Homo sapiens ] |
| Official Symbol | CDH19 |
| Synonyms | CDH19; cadherin 19, type 2; cadherin-19; CDH7; CDH7L2; |
| Gene ID | 28513 |
| mRNA Refseq | NM_021153 |
| Protein Refseq | NP_066976 |
| MIM | 603016 |
| UniProt ID | Q9H159 |
| ◆ Recombinant Proteins | ||
| CDH19-3719H | Recombinant Human CDH19 protein, His-tagged | +Inquiry |
| CDH19-332H | Recombinant Human CDH19 protein, GST-tagged | +Inquiry |
| CDH19-3728C | Recombinant Chicken CDH19 | +Inquiry |
| CDH19-1413H | Recombinant Human CDH19 protein, MBP-Flag-tagged | +Inquiry |
| CDH19-694HF | Recombinant Full Length Human CDH19 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH19-325HCL | Recombinant Human CDH19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH19 Products
Required fields are marked with *
My Review for All CDH19 Products
Required fields are marked with *
