Recombinant Human CDH2
Cat.No. : | CDH2-28769TH |
Product Overview : | Recombinant fragment (amino acids 807-906) of Human N Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 10.80 kDa), 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry. At certain central nervous system synapses, presynaptic to postsynaptic adhesion is mediated at least in part by this gene product. |
Molecular Weight : | 36.630kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
Sequence Similarities : | Contains 5 cadherin domains. |
Gene Name | CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ] |
Official Symbol | CDH2 |
Synonyms | CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; |
Gene ID | 1000 |
mRNA Refseq | NM_001792 |
Protein Refseq | NP_001783 |
MIM | 114020 |
Uniprot ID | P19022 |
Chromosome Location | 18q12.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; |
Function | RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; |
◆ Recombinant Proteins | ||
CDH2-2360H | Recombinant Human CDH2 protein(Met1-Ala724), His&hFc-tagged | +Inquiry |
CDH2-877HFL | Recombinant Full Length Human CDH2 Protein, C-Flag-tagged | +Inquiry |
CDH2-2191H | Recombinant Human CDH2 protein(Met1-Ala724), His-tagged | +Inquiry |
Cdh2-21M | Recombinant Mouse Cdh2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cdh2-7026R | Recombinant Rat Cdh2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CDH2-3153H | Recombinant Human CDH2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH2-971MCL | Recombinant Mouse CDH2 cell lysate | +Inquiry |
CDH2-980HCL | Recombinant Human CDH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH2 Products
Required fields are marked with *
My Review for All CDH2 Products
Required fields are marked with *