Recombinant Human CDH2

Cat.No. : CDH2-28769TH
Product Overview : Recombinant fragment (amino acids 807-906) of Human N Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 10.80 kDa), 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry. At certain central nervous system synapses, presynaptic to postsynaptic adhesion is mediated at least in part by this gene product.
Molecular Weight : 36.630kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Sequence Similarities : Contains 5 cadherin domains.
Gene Name CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
Official Symbol CDH2
Synonyms CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin;
Gene ID 1000
mRNA Refseq NM_001792
Protein Refseq NP_001783
MIM 114020
Uniprot ID P19022
Chromosome Location 18q12.1
Pathway Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem;
Function RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH2 Products

Required fields are marked with *

My Review for All CDH2 Products

Required fields are marked with *

0
cart-icon