Recombinant Human CDH2 protein, GST-tagged
Cat.No. : | CDH2-4938H |
Product Overview : | Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 421 - 535 aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
Molecular Mass : | 39 kDa |
AA Sequence : | RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT |
Purity : | > 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ] |
Official Symbol | CDH2 |
Synonyms | CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325; |
Gene ID | 1000 |
mRNA Refseq | NM_001792 |
Protein Refseq | NP_001783 |
MIM | 114020 |
UniProt ID | P19022 |
Chromosome Location | 18q12.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; |
Function | RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; protein kinase binding; protein phosphatase binding; |
◆ Recombinant Proteins | ||
CDH2-2360H | Recombinant Human CDH2 protein(Met1-Ala724), His&hFc-tagged | +Inquiry |
CDH2-1740R | Recombinant Rhesus Monkey CDH2 Protein | +Inquiry |
CDH2-3848H | Recombinant Human CDH2 Protein (Met1-Ala724), C-His tagged | +Inquiry |
RFL12778HF | Recombinant Full Length Human Cadherin-2(Cdh2) Protein, His-Tagged | +Inquiry |
Cdh2-7026R | Recombinant Rat Cdh2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CDH2-3153H | Recombinant Human CDH2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH2-971MCL | Recombinant Mouse CDH2 cell lysate | +Inquiry |
CDH2-980HCL | Recombinant Human CDH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH2 Products
Required fields are marked with *
My Review for All CDH2 Products
Required fields are marked with *
0
Inquiry Basket