Recombinant Human CDH2 protein, GST-tagged
| Cat.No. : | CDH2-4938H |
| Product Overview : | Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli. |
| Availability | November 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 421 - 535 aa |
| Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
| Molecular Mass : | 39 kDa |
| AA Sequence : | RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT |
| Purity : | > 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ] |
| Official Symbol | CDH2 |
| Synonyms | CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325; |
| Gene ID | 1000 |
| mRNA Refseq | NM_001792 |
| Protein Refseq | NP_001783 |
| MIM | 114020 |
| UniProt ID | P19022 |
| Chromosome Location | 18q12.1 |
| Pathway | Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; |
| Function | RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; protein kinase binding; protein phosphatase binding; |
| ◆ Recombinant Proteins | ||
| CDH2-877HFL | Recombinant Full Length Human CDH2 Protein, C-Flag-tagged | +Inquiry |
| Cdh2-861M | Recombinant Mouse Cdh2 Protein, MYC/DDK-tagged | +Inquiry |
| CDH2-7023H | Recombinant Human CDH2 protein, His-tagged | +Inquiry |
| CDH2-1742R | Recombinant Rhesus Monkey CDH2 Protein, hIgG4-tagged | +Inquiry |
| CDH2-271H | Recombinant Human CDH2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH2-980HCL | Recombinant Human CDH2 cell lysate | +Inquiry |
| CDH2-971MCL | Recombinant Mouse CDH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH2 Products
Required fields are marked with *
My Review for All CDH2 Products
Required fields are marked with *
