"CDH2" Related Products

Expand
Expand

Recombinant Human CDH2 protein, GST-tagged

Cat.No.: CDH2-4938H
Product Overview: Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: GST
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass: 39 kDa
Protein length: 421 - 535 aa
AA Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT
Purity: > 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage: Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name: CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
Official Symbol: CDH2
Synonyms: CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325;
Gene ID: 1000
mRNA Refseq: NM_001792
Protein Refseq: NP_001783
MIM: 114020
UniProt ID: P19022
Chromosome Location: 18q12.1
Pathway: Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem;
Function: RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; protein kinase binding; protein phosphatase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.