Recombinant Human CDH2 protein, GST-tagged

Cat.No. : CDH2-4938H
Product Overview : Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability August 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 421 - 535 aa
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass : 39 kDa
AA Sequence : RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT
Purity : > 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage : Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
Official Symbol CDH2
Synonyms CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325;
Gene ID 1000
mRNA Refseq NM_001792
Protein Refseq NP_001783
MIM 114020
UniProt ID P19022
Chromosome Location 18q12.1
Pathway Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem;
Function RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; protein kinase binding; protein phosphatase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH2 Products

Required fields are marked with *

My Review for All CDH2 Products

Required fields are marked with *

0
cart-icon