Recombinant Human CDH9 protein, His-tagged
| Cat.No. : | CDH9-7751H |
| Product Overview : | Recombinant Human CDH9(Ile22-Ala615) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ile22-Ala615 |
| Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| AA Sequence : | ILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDG AGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEM SGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMG GLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITD KDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDV KEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSH IPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNT AGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGAVDHHHH HH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Shipping : | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Gene Name | CDH9 cadherin 9, type 2 (T1-cadherin) [ Homo sapiens ] |
| Official Symbol | CDH9 |
| Synonyms | CDH9; cadherin 9, type 2 (T1-cadherin); cadherin-9; T1-cadherin; MGC125386; |
| Gene ID | 1007 |
| mRNA Refseq | NM_016279 |
| Protein Refseq | NP_057363 |
| MIM | 609974 |
| UniProt ID | Q9ULB4 |
| Chromosome Location | 5p14 |
| Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
| Function | calcium ion binding; molecular_function; |
| ◆ Recombinant Proteins | ||
| CDH9-0110H | Recombinant Human CDH9 Protein (Ile22-Ala615), C-His-tagged | +Inquiry |
| Cdh9-4896M | Recombinant Mouse Cdh9 protein | +Inquiry |
| Cdh9-4894M | Recombinant Mouse Cdh9 protein | +Inquiry |
| Cdh9-4893M | Recombinant Mouse Cdh9 protein | +Inquiry |
| Cdh9-4897M | Recombinant Mouse Cdh9 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH9 Products
Required fields are marked with *
My Review for All CDH9 Products
Required fields are marked with *



