Recombinant Human CDH9 protein, His-tagged
Cat.No. : | CDH9-7751H |
Product Overview : | Recombinant Human CDH9(Ile22-Ala615) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ile22-Ala615 |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | ILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDG AGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEM SGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMG GLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITD KDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDV KEGSIIGQVTAYDPDARNNLIKYSVDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSH IPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNT AGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGAVDHHHH HH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Shipping : | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
Gene Name | CDH9 cadherin 9, type 2 (T1-cadherin) [ Homo sapiens ] |
Official Symbol | CDH9 |
Synonyms | CDH9; cadherin 9, type 2 (T1-cadherin); cadherin-9; T1-cadherin; MGC125386; |
Gene ID | 1007 |
mRNA Refseq | NM_016279 |
Protein Refseq | NP_057363 |
MIM | 609974 |
UniProt ID | Q9ULB4 |
Chromosome Location | 5p14 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | calcium ion binding; molecular_function; |
◆ Recombinant Proteins | ||
CDH9-0110H | Recombinant Human CDH9 Protein (Ile22-Ala615), C-His-tagged | +Inquiry |
Cdh9-4896M | Recombinant Mouse Cdh9 protein | +Inquiry |
Cdh9-4895M | Recombinant Mouse Cdh9 protein, Avi-tagged, Biotinylated | +Inquiry |
Cdh9-4894M | Recombinant Mouse Cdh9 protein | +Inquiry |
Cdh9-4893M | Recombinant Mouse Cdh9 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH9 Products
Required fields are marked with *
My Review for All CDH9 Products
Required fields are marked with *