Recombinant Human CDK11B Protein, GST-tagged

Cat.No. : CDK11B-5130H
Product Overview : Human CDC2L1 partial ORF ( NP_001778, 686 a.a. - 795 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Molecular Mass : 37.84 kDa
AA Sequence : KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK11B cyclin dependent kinase 11B [ Homo sapiens (human) ]
Official Symbol CDK11B
Synonyms CDC2L1; CDK11B; cyclin dependent kinase 11B; p58; PK58; CDK11; CLK-1; CDC2L1; PITSLREA; p58CLK-1; CDK11-p46; CDK11-p58; p58CDC2L1; CDK11-p110; cyclin-dependent kinase 11B; CDC-related protein kinase p58; PITSLRE serine/threonine-protein kinase CDC2L1; cell division cycle 2-like 1 (PITSLRE proteins); cell division protein kinase 11B; galactosyltransferase-associated protein kinase p58/GTA; p58 CLK-1; EC 2.7.11.22
Gene ID 984
mRNA Refseq NM_001291345
Protein Refseq NP_001278274
MIM 176873
UniProt ID P21127

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK11B Products

Required fields are marked with *

My Review for All CDK11B Products

Required fields are marked with *

0
cart-icon
0
compare icon