Recombinant Human CDK11B Protein, GST-tagged
Cat.No. : | CDK11B-5130H |
Product Overview : | Human CDC2L1 partial ORF ( NP_001778, 686 a.a. - 795 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK11B cyclin dependent kinase 11B [ Homo sapiens (human) ] |
Official Symbol | CDK11B |
Synonyms | CDC2L1; CDK11B; cyclin dependent kinase 11B; p58; PK58; CDK11; CLK-1; CDC2L1; PITSLREA; p58CLK-1; CDK11-p46; CDK11-p58; p58CDC2L1; CDK11-p110; cyclin-dependent kinase 11B; CDC-related protein kinase p58; PITSLRE serine/threonine-protein kinase CDC2L1; cell division cycle 2-like 1 (PITSLRE proteins); cell division protein kinase 11B; galactosyltransferase-associated protein kinase p58/GTA; p58 CLK-1; EC 2.7.11.22 |
Gene ID | 984 |
mRNA Refseq | NM_001291345 |
Protein Refseq | NP_001278274 |
MIM | 176873 |
UniProt ID | P21127 |
◆ Recombinant Proteins | ||
CDK11B-127H | Recombinant Human CDK11B, GST-tagged | +Inquiry |
CDK11B-958R | Recombinant Rat CDK11B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK11B-1300R | Recombinant Rat CDK11B Protein | +Inquiry |
CDK11B-723H | Recombinant Human CDK11B Protein, His-tagged | +Inquiry |
CDK11B-1932Z | Recombinant Zebrafish CDK11B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK11B Products
Required fields are marked with *
My Review for All CDK11B Products
Required fields are marked with *
0
Inquiry Basket