Recombinant Human CDK16, His-tagged
Cat.No. : | CDK16-29485TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 338-496 of Human PCTAIRE1 with N terminal His tag; 159 amino acids, 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 338-496 a.a. |
Description : | The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRI LGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRL DSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVD TEF |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain. |
Gene Name | CDK16 cyclin-dependent kinase 16 [ Homo sapiens ] |
Official Symbol | CDK16 |
Synonyms | CDK16; cyclin-dependent kinase 16; PCTAIRE protein kinase 1 , PCTK1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE; serine/threonine protein kinase; |
Gene ID | 5127 |
mRNA Refseq | NM_001170460 |
Protein Refseq | NP_001163931 |
MIM | 311550 |
Uniprot ID | Q00536 |
Chromosome Location | Xp11 |
Function | ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
CDK16-115H | Active Recombinant Human PCTK1 (CDK16)/CyclinY, GST-tagged | +Inquiry |
CDK16-3147H | Recombinant Human CDK16 Protein, MYC/DDK-tagged | +Inquiry |
CDK16-340H | Recombinant Human cyclin-dependent kinase 16, His-tagged | +Inquiry |
CDK16-1518M | Recombinant Mouse CDK16 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK16-3195M | Recombinant Mouse CDK16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK16-611HCL | Recombinant Human CDK16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK16 Products
Required fields are marked with *
My Review for All CDK16 Products
Required fields are marked with *