Recombinant Human CDK16, His-tagged

Cat.No. : CDK16-29485TH
Product Overview : Recombinant fragment, corresponding to amino acids 338-496 of Human PCTAIRE1 with N terminal His tag; 159 amino acids, 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 338-496 a.a.
Description : The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRI LGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRL DSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVD TEF
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.
Gene Name CDK16 cyclin-dependent kinase 16 [ Homo sapiens ]
Official Symbol CDK16
Synonyms CDK16; cyclin-dependent kinase 16; PCTAIRE protein kinase 1 , PCTK1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE; serine/threonine protein kinase;
Gene ID 5127
mRNA Refseq NM_001170460
Protein Refseq NP_001163931
MIM 311550
Uniprot ID Q00536
Chromosome Location Xp11
Function ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK16 Products

Required fields are marked with *

My Review for All CDK16 Products

Required fields are marked with *

0
cart-icon