Recombinant Human CDK17 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDK17-4059H |
Product Overview : | CDK17 MS Standard C13 and N15-labeled recombinant protein (NP_002586) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to a rat protein that is thought to play a role in terminally differentiated neurons. Alternatively spliced transcript variants encoding different isoforms have been found. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDK17 cyclin-dependent kinase 17 [ Homo sapiens (human) ] |
Official Symbol | CDK17 |
Synonyms | CDK17; cyclin-dependent kinase 17; PCTAIRE protein kinase 2, PCTK2; PCTAIRE2; PCTAIRE-motif protein kinase 2; cell division protein kinase 17; protein kinase cdc2-related PCTAIRE-2; serine/threonine-protein kinase PCTAIRE-2; PCTK2; |
Gene ID | 5128 |
mRNA Refseq | NM_002595 |
Protein Refseq | NP_002586 |
MIM | 603440 |
UniProt ID | Q00537 |
◆ Recombinant Proteins | ||
CDK17-781R | Recombinant Rhesus monkey CDK17 Protein, His-tagged | +Inquiry |
CDK17-3196M | Recombinant Mouse CDK17 Protein | +Inquiry |
CDK17-1519M | Recombinant Mouse CDK17 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK17-7920Z | Recombinant Zebrafish CDK17 | +Inquiry |
Cdk17-2086M | Recombinant Mouse Cdk17 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK17-7632HCL | Recombinant Human CDK17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK17 Products
Required fields are marked with *
My Review for All CDK17 Products
Required fields are marked with *