Recombinant Human CDK5 protein, His-SUMO-tagged
Cat.No. : | CDK5-2679H |
Product Overview : | Recombinant Human CDK5 protein(Q00535)(1-292aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-292aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CDK5 cyclin-dependent kinase 5 [ Homo sapiens ] |
Official Symbol | CDK5 |
Synonyms | CDK5; cyclin-dependent kinase 5; PSSALRE; TPKII catalytic subunit; protein kinase CDK5 splicing; cell division protein kinase 5; serine/threonine-protein kinase PSSALRE; tau protein kinase II catalytic subunit; |
Gene ID | 1020 |
mRNA Refseq | NM_001164410 |
Protein Refseq | NP_001157882 |
MIM | 123831 |
UniProt ID | Q00535 |
◆ Recombinant Proteins | ||
Cdk5-866M | Recombinant Mouse Cdk5 Protein, MYC/DDK-tagged | +Inquiry |
CDK5-1305R | Recombinant Rat CDK5 Protein | +Inquiry |
CDK5-382H | Active Recombinant Human CDK5&p35 protein, GST-tagged | +Inquiry |
CDK5-3185HF | Recombinant Full Length Human CDK5 Protein, GST-tagged | +Inquiry |
CDK5-4468HF | Active Recombinant Full Length Human CDK5 Protein, DDK-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5-7626HCL | Recombinant Human CDK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is CDK5 derived from human fetal cell lines?
03/28/2023
The CDK5 is expressed from HEK293 host, which is a mammalian cells system.
Ask a Question for All CDK5 Products
Required fields are marked with *
My Review for All CDK5 Products
Required fields are marked with *
0
Inquiry Basket