"CDK7" Related Products

Expand
Expand

Recombinant Human CDK7 Protein, GST-Tagged

Cat.No.: CDK7-1033H
Product Overview: Human CDK7 full-length ORF (AAH00834.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 63.58 kDa
AA Sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CDK7 cyclin-dependent kinase 7 [ Homo sapiens ]
Official Symbol: CDK7
Synonyms: CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase), cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15;
Gene ID: 1022
mRNA Refseq: NM_001799
Protein Refseq: NP_001790
MIM: 601955
UniProt ID: P50613

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.