Recombinant Human CDKL1 Protein, GST-Tagged

• Cat.No.: CDKL1-1045H
• Product Overview: Human CDKL1 partial ORF (NP_004187, 259 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
• Molecular Mass: 36.63 kDa
• AA Sequence: YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKL1 cyclin-dependent kinase-like 1 (CDC2-related kinase) [ Homo sapiens ]
• Official Symbol: CDKL1
• Synonyms: CDKL1; cyclin-dependent kinase-like 1 (CDC2-related kinase); cyclin-dependent kinase-like 1; KKIALRE; CDC2-related kinase 1; protein kinase p42 KKIALRE; serine/threonine protein kinase KKIALRE; serine/threonine-protein kinase KKIALRE; P42
• Gene ID: 8814
• mRNA Refseq: NM_004196
• Protein Refseq: NP_004187
• MIM: 603441
• UniProt ID: Q00532