Recombinant Human CDKL1 Protein, GST-Tagged

Cat.No. : CDKL1-1045H
Product Overview : Human CDKL1 partial ORF (NP_004187, 259 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
Molecular Mass : 36.63 kDa
AA Sequence : YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKL1 cyclin-dependent kinase-like 1 (CDC2-related kinase) [ Homo sapiens ]
Official Symbol CDKL1
Synonyms CDKL1; cyclin-dependent kinase-like 1 (CDC2-related kinase); cyclin-dependent kinase-like 1; KKIALRE; CDC2-related kinase 1; protein kinase p42 KKIALRE; serine/threonine protein kinase KKIALRE; serine/threonine-protein kinase KKIALRE; P42;
Gene ID 8814
mRNA Refseq NM_004196
Protein Refseq NP_004187
MIM 603441
UniProt ID Q00532

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKL1 Products

Required fields are marked with *

My Review for All CDKL1 Products

Required fields are marked with *

0
cart-icon