Recombinant Human CDKL1 Protein, GST-Tagged
Cat.No. : | CDKL1-1045H |
Product Overview : | Human CDKL1 partial ORF (NP_004187, 259 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKL1 cyclin-dependent kinase-like 1 (CDC2-related kinase) [ Homo sapiens ] |
Official Symbol | CDKL1 |
Synonyms | CDKL1; cyclin-dependent kinase-like 1 (CDC2-related kinase); cyclin-dependent kinase-like 1; KKIALRE; CDC2-related kinase 1; protein kinase p42 KKIALRE; serine/threonine protein kinase KKIALRE; serine/threonine-protein kinase KKIALRE; P42; |
Gene ID | 8814 |
mRNA Refseq | NM_004196 |
Protein Refseq | NP_004187 |
MIM | 603441 |
UniProt ID | Q00532 |
◆ Recombinant Proteins | ||
CDKL1-529H | Recombinant Human CDKL1 Protein, GST-His-tagged | +Inquiry |
CDKL1-1310R | Recombinant Rat CDKL1 Protein | +Inquiry |
CDKL1-174H | Recombinant Human CDKL1, GST-tagged | +Inquiry |
CDKL1-968R | Recombinant Rat CDKL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKL1-1107Z | Recombinant Zebrafish CDKL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKL1-7619HCL | Recombinant Human CDKL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKL1 Products
Required fields are marked with *
My Review for All CDKL1 Products
Required fields are marked with *