Recombinant Human CDKL4 Protein, GST-Tagged

Cat.No. : CDKL4-1051H
Product Overview : Human CDKL4 partial ORF (AAV63975, 196 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CDKL4 (Cyclin Dependent Kinase Like 4) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDKL1.
Molecular Mass : 36.63 kDa
AA Sequence : TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKL4 cyclin-dependent kinase-like 4 [ Homo sapiens ]
Official Symbol CDKL4
Synonyms CDKL4; cyclin-dependent kinase-like 4;
Gene ID 344387
mRNA Refseq NM_001009565
Protein Refseq NP_001009565
UniProt ID Q5MAI5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKL4 Products

Required fields are marked with *

My Review for All CDKL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon