Recombinant Human CDKL4 Protein, GST-Tagged
Cat.No. : | CDKL4-1051H |
Product Overview : | Human CDKL4 partial ORF (AAV63975, 196 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CDKL4 (Cyclin Dependent Kinase Like 4) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDKL1. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKL4 cyclin-dependent kinase-like 4 [ Homo sapiens ] |
Official Symbol | CDKL4 |
Synonyms | CDKL4; cyclin-dependent kinase-like 4; |
Gene ID | 344387 |
mRNA Refseq | NM_001009565 |
Protein Refseq | NP_001009565 |
UniProt ID | Q5MAI5 |
◆ Recombinant Proteins | ||
CDKL4-3218M | Recombinant Mouse CDKL4 Protein | +Inquiry |
CDKL4-1051H | Recombinant Human CDKL4 Protein, GST-Tagged | +Inquiry |
CDKL4-1533M | Recombinant Mouse CDKL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKL4-176H | Recombinant Human CDKL4, GST-tagged | +Inquiry |
CDKL4-375H | Recombinant Human CDKL4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKL4 Products
Required fields are marked with *
My Review for All CDKL4 Products
Required fields are marked with *