Recombinant Human CDKN1A protein, GST-tagged
Cat.No. : | CDKN1A-4215H |
Product Overview : | Recombinant Human CDKN1A protein(72-164 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 72-164 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP |
Gene Name | CDKN1A cyclin-dependent kinase inhibitor 1A (p21, Cip1) [ Homo sapiens ] |
Official Symbol | CDKN1A |
Synonyms | CDKN1A; cyclin-dependent kinase inhibitor 1A (p21, Cip1); CDKN1; cyclin-dependent kinase inhibitor 1; CAP20; CIP1; P21; p21CIP1; p21Cip1/Waf1; SDI1; WAF1; DNA synthesis inhibitor; CDK-interacting protein 1; CDK-interaction protein 1; wild-type p53-activated fragment 1; melanoma differentiation associated protein 6; MDA-6; |
Gene ID | 1026 |
mRNA Refseq | NM_000389 |
Protein Refseq | NP_000380 |
MIM | 116899 |
UniProt ID | P38936 |
◆ Recombinant Proteins | ||
CDKN1A-045H | Recombinant Human CDKN1A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN1A-4215H | Recombinant Human CDKN1A protein, GST-tagged | +Inquiry |
CDKN1A-619R | Recombinant Rhesus Macaque CDKN1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN1A-793R | Recombinant Rhesus monkey CDKN1A Protein, His-tagged | +Inquiry |
CDKN1A-7157H | Recombinant Human Cyclin-Dependent Kinase Inhibitor 1A (p21, Cip1), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN1A-7618HCL | Recombinant Human CDKN1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN1A Products
Required fields are marked with *
My Review for All CDKN1A Products
Required fields are marked with *