Recombinant Human CDNF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDNF-5915H |
Product Overview : | CDNF MS Standard C13 and N15-labeled recombinant protein (NP_001025125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CDNF (Cerebral Dopamine Neurotrophic Factor) is a Protein Coding gene. Diseases associated with CDNF include Baritosis and Indolent Systemic Mastocytosis. Gene Ontology (GO) annotations related to this gene include growth factor activity. An important paralog of this gene is MANF. |
Molecular Mass : | 21 kDa |
AA Sequence : | MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDNF cerebral dopamine neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | CDNF |
Synonyms | CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1, ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1; |
Gene ID | 441549 |
mRNA Refseq | NM_001029954 |
Protein Refseq | NP_001025125 |
MIM | 611233 |
UniProt ID | Q49AH0 |
◆ Recombinant Proteins | ||
CDNF-484H | Recombinant Human CDNF Protein, His/GST-tagged | +Inquiry |
Cdnf-3799M | Recombinant Mouse Cdnf protein, His-tagged | +Inquiry |
CDNF-716H | Recombinant Human CDNF Protein, His-tagged | +Inquiry |
CDNF-592H | Active Recombinant Human CDNF, His-tagged | +Inquiry |
CDNF-231H | Recombinant Human CDNF Protein (Gln27-Leu187), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDNF-2028MCL | Recombinant Mouse CDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDNF Products
Required fields are marked with *
My Review for All CDNF Products
Required fields are marked with *