Recombinant Human CDON Protein, GST-Tagged
Cat.No. : | CDON-1071H |
Product Overview : | Human CDON partial ORF (NP_058648, 1155 a.a. - 1263 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cell surface receptor that is a member of the immunoglobulin superfamily. The encoded protein contains three fibronectin type III domains and five immunoglobulin-like C2-type domains. This protein is a member of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells and positively regulates myogenesis. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDON Cdon homolog (mouse) [ Homo sapiens ] |
Official Symbol | CDON |
Synonyms | CDON; Cdon homolog (mouse); cell adhesion molecule related/down regulated by oncogenes; cell adhesion molecule-related/down-regulated by oncogenes; CDO; ORCAM; surface glycoprotein, Ig superfamily member; HPE11; MGC111524; |
Gene ID | 50937 |
mRNA Refseq | NM_001243597 |
Protein Refseq | NP_001230526 |
MIM | 608707 |
UniProt ID | Q4KMG0 |
◆ Recombinant Proteins | ||
CDON-1543M | Recombinant Mouse CDON Protein, His (Fc)-Avi-tagged | +Inquiry |
CDON-707H | Active Recombinant Human CDON Protein, His-tagged | +Inquiry |
CDON-1173H | Recombinant Human CDON protein, His-tagged | +Inquiry |
Cdon-1272R | Recombinant Rat Cdon Protein, His-tagged | +Inquiry |
CDON-2154H | Recombinant Human CDON Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDON-1961HCL | Recombinant Human CDON cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDON Products
Required fields are marked with *
My Review for All CDON Products
Required fields are marked with *