Recombinant Human CDR2L protein, GST-tagged
Cat.No. : | CDR2L-129H |
Product Overview : | Recombinant Human CDR2L(1 a.a. - 459 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 459 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHA KVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIH TFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELE RQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPA ASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGV RHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINA TKVKTHSSK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CDR2L cerebellar degeneration-related protein 2-like [ Homo sapiens ] |
Official Symbol | CDR2L |
Synonyms | cdr2l; CDR2L_HUMAN; Cerebellar degeneration-related protein 2-like; Gm21; Paraneoplastic 62 kDa antigen; paraneoplastic antigen; HUMPPA |
Gene ID | 30850 |
mRNA Refseq | NM_014603.2 |
Protein Refseq | NP_055418.2 |
MIM | |
UniProt ID | Q86X02 |
Chromosome Location | 17q25.1 |
◆ Recombinant Proteins | ||
CDR2L-3235M | Recombinant Mouse CDR2L Protein | +Inquiry |
CDR2L-11069H | Recombinant Human CDR2L, GST-tagged | +Inquiry |
CDR2L-802R | Recombinant Rhesus monkey CDR2L Protein, His-tagged | +Inquiry |
CDR2L-129H | Recombinant Human CDR2L protein, GST-tagged | +Inquiry |
CDR2L-11608Z | Recombinant Zebrafish CDR2L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDR2L Products
Required fields are marked with *
My Review for All CDR2L Products
Required fields are marked with *