Recombinant Human CDR2L protein, GST-tagged
| Cat.No. : | CDR2L-129H | 
| Product Overview : | Recombinant Human CDR2L(1 a.a. - 459 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Protein Length : | 1 a.a. - 459 a.a. | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 50.5 kDa | 
| AA Sequence : | MEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHA KVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIH TFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELE RQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPA ASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGV RHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINA TKVKTHSSK | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Gene Name | CDR2L cerebellar degeneration-related protein 2-like [ Homo sapiens ] | 
| Official Symbol | CDR2L | 
| Synonyms | cdr2l; CDR2L_HUMAN; Cerebellar degeneration-related protein 2-like; Gm21; Paraneoplastic 62 kDa antigen; paraneoplastic antigen; HUMPPA | 
| Gene ID | 30850 | 
| mRNA Refseq | NM_014603.2 | 
| Protein Refseq | NP_055418.2 | 
| MIM | |
| UniProt ID | Q86X02 | 
| Chromosome Location | 17q25.1 | 
| ◆ Recombinant Proteins | ||
| CDR2L-11069H | Recombinant Human CDR2L, GST-tagged | +Inquiry | 
| CDR2L-3235M | Recombinant Mouse CDR2L Protein | +Inquiry | 
| CDR2L-1545M | Recombinant Mouse CDR2L Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CDR2L-129H | Recombinant Human CDR2L protein, GST-tagged | +Inquiry | 
| CDR2L-628R | Recombinant Rhesus Macaque CDR2L Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDR2L Products
Required fields are marked with *
My Review for All CDR2L Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            