Recombinant Human CDX1 Protein, GST-Tagged
| Cat.No. : | CDX1-1082H |
| Product Overview : | Human CDX1 partial ORF (NP_001795, 126 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDX1 caudal type homeobox 1 [ Homo sapiens ] |
| Official Symbol | CDX1 |
| Synonyms | CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1; caudal-type homeobox protein 1; caudal-type homeobox protein CDX1; caudal type homeobox transcription factor 1; MGC116915; |
| Gene ID | 1044 |
| mRNA Refseq | NM_001804 |
| Protein Refseq | NP_001795 |
| MIM | 600746 |
| UniProt ID | P47902 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX1 Products
Required fields are marked with *
My Review for All CDX1 Products
Required fields are marked with *



