Recombinant Human CDX1 Protein, GST-Tagged

Cat.No. : CDX1-1082H
Product Overview : Human CDX1 partial ORF (NP_001795, 126 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.64 kDa
AA Sequence : GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDX1 caudal type homeobox 1 [ Homo sapiens ]
Official Symbol CDX1
Synonyms CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1; caudal-type homeobox protein 1; caudal-type homeobox protein CDX1; caudal type homeobox transcription factor 1; MGC116915;
Gene ID 1044
mRNA Refseq NM_001804
Protein Refseq NP_001795
MIM 600746
UniProt ID P47902

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDX1 Products

Required fields are marked with *

My Review for All CDX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon