Recombinant Human CDY2A Protein, GST-Tagged
| Cat.No. : | CDY2A-1085H | 
| Product Overview : | Human CDY2 partial ORF (NP_004816, 123 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This intronless gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. Two nearly identical copies of this gene are found in a palindromic region on chromosome Y; this record represents the telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 35.86 kDa | 
| AA Sequence : | ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CDY2A chromodomain protein, Y-linked, 2A [ Homo sapiens ] | 
| Official Symbol | CDY2A | 
| Synonyms | CDY2A; chromodomain protein, Y-linked, 2A; CDY2, chromodomain protein, Y chromosome, 2, chromodomain protein, Y linked, 2; testis-specific chromodomain protein Y 2; Y chromosome chromodomain protein 2A; chromodomain protein, Y chromosome, 2; testis-specific chromodomain protein Y protein 2; CDY; CDY2; CDY2B; | 
| Gene ID | 9426 | 
| mRNA Refseq | NM_004825 | 
| Protein Refseq | NP_004816 | 
| MIM | 400018 | 
| UniProt ID | Q9Y6F7 | 
| ◆ Recombinant Proteins | ||
| CDY2A-1085H | Recombinant Human CDY2A Protein, GST-Tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDY2A Products
Required fields are marked with *
My Review for All CDY2A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            