Recombinant Human CEACAM1 protein(151-230 aa), C-His-tagged
| Cat.No. : | CEACAM1-2650H |
| Product Overview : | Recombinant Human CEACAM1 protein(P13688)(151-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151-230 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVT |
| Gene Name | CEACAM1 carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) [ Homo sapiens ] |
| Official Symbol | CEACAM1 |
| Synonyms | CEACAM1; carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein); BGP; carcinoembryonic antigen-related cell adhesion molecule 1; BGP1; CD66a; antigen CD66; CD66a antigen; BGPI; |
| Gene ID | 634 |
| mRNA Refseq | NM_001024912 |
| Protein Refseq | NP_001020083 |
| MIM | 109770 |
| UniProt ID | P13688 |
| ◆ Recombinant Proteins | ||
| CEACAM1-663H | Active Recombinant Human CEACAM1 protein(Met1-Gly428), His&hFc-tagged | +Inquiry |
| CEACAM1-178H | Recombinant Human CEACAM1 Protein, His-tagged | +Inquiry |
| CEACAM1-6372Z | Recombinant Zebrafish CEACAM1 | +Inquiry |
| CEACAM1-3272HF | Recombinant Full Length Human CEACAM1 Protein, GST-tagged | +Inquiry |
| Ceacam1-8740RAF555 | Recombinant Rat Ceacam1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM1-2214MCL | Recombinant Mouse CEACAM1 cell lysate | +Inquiry |
| CEACAM1-1239RCL | Recombinant Rat CEACAM1 cell lysate | +Inquiry |
| CEACAM1-3039HCL | Recombinant Human CEACAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM1 Products
Required fields are marked with *
My Review for All CEACAM1 Products
Required fields are marked with *
