Recombinant Human CEACAM1 protein(151-230 aa), C-His-tagged

• Cat.No.: CEACAM1-2650H
• Product Overview: Recombinant Human CEACAM1 protein(P13688)(151-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVT

Gene Information

• Gene Name: CEACAM1 carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) [ Homo sapiens ]
• Official Symbol: CEACAM1
• Synonyms: CEACAM1; carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein); BGP; carcinoembryonic antigen-related cell adhesion molecule 1; BGP1; CD66a; antigen CD66; CD66a antigen; BGPI
• Gene ID: 634
• mRNA Refseq: NM_001024912
• Protein Refseq: NP_001020083
• MIM: 109770
• UniProt ID: P13688