Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CEACAM4-2278H
Product Overview : CEACAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001808) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Molecular Mass : 25.7 kDa
AA Sequence : MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens (human) ]
Official Symbol CEACAM4
Synonyms CEACAM4; carcinoembryonic antigen-related cell adhesion molecule 4; CGM7; carcinoembryonic antigen CGM7; nonspecific cross-reacting antigen W236; Nonspecific cross-reacting antigen (NCA); non-specific cross-reacting antigen W236; carcinoembryonic antigen gene family member 7; NCA; CGM7_HUMAN;
Gene ID 1089
mRNA Refseq NM_001817
Protein Refseq NP_001808
UniProt ID O75871

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM4 Products

Required fields are marked with *

My Review for All CEACAM4 Products

Required fields are marked with *

0
cart-icon