Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CEACAM4-2278H |
Product Overview : | CEACAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001808) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens (human) ] |
Official Symbol | CEACAM4 |
Synonyms | CEACAM4; carcinoembryonic antigen-related cell adhesion molecule 4; CGM7; carcinoembryonic antigen CGM7; nonspecific cross-reacting antigen W236; Nonspecific cross-reacting antigen (NCA); non-specific cross-reacting antigen W236; carcinoembryonic antigen gene family member 7; NCA; CGM7_HUMAN; |
Gene ID | 1089 |
mRNA Refseq | NM_001817 |
Protein Refseq | NP_001808 |
UniProt ID | O75871 |
◆ Recombinant Proteins | ||
CEACAM4-1356H | Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged | +Inquiry |
CEACAM4-571H | Recombinant Human CEACAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM4-2278H | Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CEACAM4-1553HFL | Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged | +Inquiry |
CEACAM4-3193H | Recombinant Human CEACAM4 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM4 Products
Required fields are marked with *
My Review for All CEACAM4 Products
Required fields are marked with *
0
Inquiry Basket