Recombinant Human CEACAM8 Protein, His-SUMO-tagged
| Cat.No. : | CEACAM8-1162H |
| Product Overview : | Recombinant Human CEACAM8 Protein (35-320aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 35-320 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] |
| Official Symbol | CEACAM8 |
| Synonyms | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b |
| Gene ID | 1088 |
| mRNA Refseq | NM_001816 |
| Protein Refseq | NP_001807 |
| UniProt ID | P31997 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *



