Recombinant Human CEACAM8 Protein, His-SUMO-tagged
Cat.No. : | CEACAM8-1162H |
Product Overview : | Recombinant Human CEACAM8 Protein (35-320aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 35-320 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 47.5 kDa |
AA Sequence : | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] |
Official Symbol | CEACAM8 |
Synonyms | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b |
Gene ID | 1088 |
mRNA Refseq | NM_001816 |
Protein Refseq | NP_001807 |
UniProt ID | P31997 |
◆ Recombinant Proteins | ||
CEACAM8-222H | Recombinant Human CEACAM8, C13&N15-labeled | +Inquiry |
CEACAM8-2983H | Active Recombinant Human CEACAM8 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CEACAM8-3276HF | Recombinant Full Length Human CEACAM8 Protein, GST-tagged | +Inquiry |
CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
CEACAM8-1007H | Recombinant Human CEACAM8 Protein (Gln35-His141), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *