Recombinant Human CEL Protein, GST-Tagged

Cat.No. : CEL-1109H
Product Overview : Human CEL partial ORF (AAH42510, 378 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEL carboxyl ester lipase (bile salt-stimulated lipase) [ Homo sapiens ]
Official Symbol CEL
Synonyms CEL; carboxyl ester lipase (bile salt-stimulated lipase); bile salt-activated lipase; BSSL; MODY8; bucelipase; sterol esterase; cholesterol esterase; carboxyl ester hydrolase; bile-salt-activated lipase; pancreatic lysophospholipase; fetoacinar pancreatic protein; lysophospholipase, pancreatic; bile salt-dependent lipase, oncofetal isoform; BAL; FAP; BSDL; CELL; FAPP; LIPA; CEase;
Gene ID 1056
mRNA Refseq NM_001807
Protein Refseq NP_001798
MIM 114840
UniProt ID P19835

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEL Products

Required fields are marked with *

My Review for All CEL Products

Required fields are marked with *

0
cart-icon
0
compare icon