Recombinant Human CEL Protein, GST-Tagged
Cat.No. : | CEL-1109H |
Product Overview : | Human CEL partial ORF (AAH42510, 378 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEL carboxyl ester lipase (bile salt-stimulated lipase) [ Homo sapiens ] |
Official Symbol | CEL |
Synonyms | CEL; carboxyl ester lipase (bile salt-stimulated lipase); bile salt-activated lipase; BSSL; MODY8; bucelipase; sterol esterase; cholesterol esterase; carboxyl ester hydrolase; bile-salt-activated lipase; pancreatic lysophospholipase; fetoacinar pancreatic protein; lysophospholipase, pancreatic; bile salt-dependent lipase, oncofetal isoform; BAL; FAP; BSDL; CELL; FAPP; LIPA; CEase; |
Gene ID | 1056 |
mRNA Refseq | NM_001807 |
Protein Refseq | NP_001798 |
MIM | 114840 |
UniProt ID | P19835 |
◆ Recombinant Proteins | ||
CEL-2168C | Recombinant Chicken CEL | +Inquiry |
CEL-0845H | Recombinant Human CEL Protein (Asp117-Glu361), N-His tagged | +Inquiry |
Cel-488M | Recombinant Mouse Cel protein, His-tagged | +Inquiry |
CEL-1109H | Recombinant Human CEL Protein, GST-Tagged | +Inquiry |
Cel-01MFL | Active Recombinant Full Length Mouse carboxyl ester lipase Protein, His Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEL Products
Required fields are marked with *
My Review for All CEL Products
Required fields are marked with *