Recombinant Human CELA1 Protein, His tagged

• Cat.No.: CELA1-002H
• Product Overview: Recombinant Human CELA1 Protein (V19-N258) with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-258 aa
• Description: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 27 kDa
• AASequence: MHHHHHHHHHHVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN
• Endotoxin: <1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: CELA1 chymotrypsin like elastase 1 [ Homo sapiens (human) ]
• Official Symbol: CELA1
• Synonyms: CELA1; chymotrypsin like elastase 1; ELA1; chymotrypsin-like elastase family member 1; chymotrypsin like elastase family member 1 elastase 1, pancreatic elastase-1 pancreatic elastase 1; EC 3.4.21.36
• Gene ID: 1990
• mRNA Refseq: NM_001971
• Protein Refseq: NP_001962
• MIM: 130120
• UniProt ID: Q9UNI1