Recombinant Human CELA3B, His-tagged
Cat.No. : | CELA3B-65H |
Product Overview : | Recombinant Human Chymotrypsin-Like Elastase Family Member 3B/CELA3B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val29-His270) of Human CELA3B fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 29-270 a.a. |
Description : | Chymotrypsin-Like Elastase Family Member 3B (CELA3B) is an enzyme that belongs to the peptidase S1 family of Elastase subfamily. CELA3B contains one peptidase S1 domain. CELA3B is expressed in the pancreas, but it is not detected in keratinocytes. CELA3B is secreted from the pancreas as a zymogen. CELA3B is an efficient protease with alanine specificity but only little elastolytic activity. CELA3B has a digestive function in the intestine. CELA3B preferentially cleaves proteins after alanine residues. CELA3B may also function in the intestinal transport and metabolism of cholesterol. |
AA Sequence : | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCY ITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNC PTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ] |
Official Symbol | CELA3B |
Synonyms | CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B; |
Gene ID | 23436 |
mRNA Refseq | NM_007352 |
Protein Refseq | NP_031378 |
UniProt ID | P08861 |
Chromosome Location | 1p36.12 |
Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
Cela3b-4853M | Recombinant Mouse Cela3b protein, His&Myc-tagged | +Inquiry |
CELA3B-3271M | Recombinant Mouse CELA3B Protein | +Inquiry |
Cela3b-1164R | Recombinant Rat Cela3b protein, His-tagged | +Inquiry |
CELA3B-3469H | Recombinant Human CELA3B Protein (Asp34-His270), N-His tagged | +Inquiry |
CELA3B-809R | Recombinant Rhesus monkey CELA3B Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3B-7591HCL | Recombinant Human CELA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELA3B Products
Required fields are marked with *
My Review for All CELA3B Products
Required fields are marked with *
0
Inquiry Basket