Recombinant Human CELA3B protein, GST-tagged
| Cat.No. : | CELA3B-257H |
| Product Overview : | Recombinant Human CELA3B(1 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-270 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 55.44 kDa |
| AA Sequence : | MMLRLLSSPLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCI SSSWTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDI LPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPT EDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ] |
| Official Symbol | CELA3B |
| Synonyms | CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B; |
| Gene ID | 23436 |
| mRNA Refseq | NM_007352 |
| Protein Refseq | NP_031378 |
| MIM | |
| UniProt ID | P08861 |
| Chromosome Location | 1p36.12 |
| Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
| Function | peptidase activity; serine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| CELA3B-650HF | Recombinant Full Length Human CELA3B Protein, GST-tagged | +Inquiry |
| CELA3B-3469H | Recombinant Human CELA3B Protein (Asp34-His270), N-His tagged | +Inquiry |
| CELA3B-3470H | Recombinant Human CELA3B Protein (Val31-His270), His tagged | +Inquiry |
| Cela3b-4853M | Recombinant Mouse Cela3b protein, His&Myc-tagged | +Inquiry |
| Cela3b-125M | Recombinant Mouse Cela3b protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CELA3B-7591HCL | Recombinant Human CELA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA3B Products
Required fields are marked with *
My Review for All CELA3B Products
Required fields are marked with *



