Recombinant Human CELF5 Protein, GST-tagged
Cat.No. : | CELF5-353H |
Product Overview : | Human BRUNOL5 full-length ORF ( AAH47522.1, 1 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 69.5 kDa |
AA Sequence : | MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CELF5 CUGBP, Elav-like family member 5 [ Homo sapiens ] |
Official Symbol | CELF5 |
Synonyms | CELF5; CUGBP, Elav-like family member 5; Bruno (Drosophila) like 5, RNA binding protein , bruno like 5, RNA binding protein (Drosophila) , BRUNOL5; CUGBP Elav-like family member 5; RNA-binding protein BRUNOL-5; CUG-BP and ETR-3 like factor 5; bruno-like 5 RNA binding protein; CELF-5; BRUNOL5; BRUNOL-5; |
Gene ID | 60680 |
mRNA Refseq | NM_001172673 |
Protein Refseq | NP_001166144 |
MIM | 612680 |
UniProt ID | Q8N6W0 |
◆ Recombinant Proteins | ||
CELF5-3818HF | Recombinant Full Length Human CELF5 Protein, GST-tagged | +Inquiry |
CELF5-6743H | Recombinant Human CELF5 protein, His-tagged | +Inquiry |
CELF5-353H | Recombinant Human CELF5 Protein, GST-tagged | +Inquiry |
Celf5-2101M | Recombinant Mouse Celf5 Protein, Myc/DDK-tagged | +Inquiry |
CELF5-3187H | Recombinant Human CELF5 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF5-184HCL | Recombinant Human CELF5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELF5 Products
Required fields are marked with *
My Review for All CELF5 Products
Required fields are marked with *