Recombinant Full Length Human CELF5 Protein, GST-tagged

Cat.No. : CELF5-3818HF
Product Overview : Human BRUNOL5 full-length ORF ( AAH47522.1, 1 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 402 amino acids
Description : Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 69.5 kDa
AA Sequence : MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CELF5 CUGBP, Elav-like family member 5 [ Homo sapiens ]
Official Symbol CELF5
Synonyms CELF5; CUGBP, Elav-like family member 5; Bruno (Drosophila) like 5, RNA binding protein , bruno like 5, RNA binding protein (Drosophila) , BRUNOL5; CUGBP Elav-like family member 5; RNA-binding protein BRUNOL-5; CUG-BP and ETR-3 like factor 5; bruno-like 5 RNA binding protein; CELF-5; BRUNOL5; BRUNOL-5;
Gene ID 60680
mRNA Refseq NM_001172673
Protein Refseq NP_001166144
MIM 612680
UniProt ID Q8N6W0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELF5 Products

Required fields are marked with *

My Review for All CELF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon