Recombinant Human CEND1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CEND1-322H
• Product Overview: CEND1 MS Standard C13 and N15-labeled recombinant protein (NP_057648) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 15 kDa
• AA Sequence: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CEND1 cell cycle exit and neuronal differentiation 1 [ Homo sapiens (human) ]
• Official Symbol: CEND1
• Synonyms: BM88; BM88 antigen; Cell cycle exit and neuronal differentiation 1; Cell cycle exit and neuronal differentiation protein 1; FLJ90066; MGC34326
• Gene ID: 51286
• mRNA Refseq: NM_016564
• Protein Refseq: NP_057648
• MIM: 608213
• UniProt ID: Q8N111