Recombinant Human CENPB protein(501-590 aa), N-MBP & C-His-tagged
Cat.No. : | CENPB-2577H |
Product Overview : | Recombinant Human CENPB protein(P07199)(501-590 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 501-590 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 53.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQA |
Gene Name | CENPB centromere protein B, 80kDa [ Homo sapiens ] |
Official Symbol | CENPB |
Synonyms | CENPB; centromere protein B, 80kDa; centromere protein B (80kD); major centromere autoantigen B; CENP-B; centromere autoantigen B; |
Gene ID | 1059 |
mRNA Refseq | NM_001810 |
Protein Refseq | NP_001801 |
MIM | 117140 |
UniProt ID | P07199 |
◆ Recombinant Proteins | ||
CENPB-740H | Recombinant Human CENPB Protein, His-tagged | +Inquiry |
CENPB-1112H | Recombinant Human CENPB Protein, GST-Tagged | +Inquiry |
CENPB-576H | Recombinant Human CENPB Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPB-3282M | Recombinant Mouse CENPB Protein | +Inquiry |
CENPB-3184H | Recombinant Human CENPB Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPB-333HCL | Recombinant Human CENPB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPB Products
Required fields are marked with *
My Review for All CENPB Products
Required fields are marked with *