Recombinant Human CENPB protein(501-590 aa), N-MBP & C-His-tagged
| Cat.No. : | CENPB-2577H |
| Product Overview : | Recombinant Human CENPB protein(P07199)(501-590 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 501-590 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 53.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQA |
| Gene Name | CENPB centromere protein B, 80kDa [ Homo sapiens ] |
| Official Symbol | CENPB |
| Synonyms | CENPB; centromere protein B, 80kDa; centromere protein B (80kD); major centromere autoantigen B; CENP-B; centromere autoantigen B; |
| Gene ID | 1059 |
| mRNA Refseq | NM_001810 |
| Protein Refseq | NP_001801 |
| MIM | 117140 |
| UniProt ID | P07199 |
| ◆ Recombinant Proteins | ||
| CENPB-4345H | Recombinant Full Length Human CENPB protein, His-tagged | +Inquiry |
| CENPB-3282M | Recombinant Mouse CENPB Protein | +Inquiry |
| CENPB-27393TH | Recombinant Human CENPB, His-tagged | +Inquiry |
| CENPB-1112H | Recombinant Human CENPB Protein, GST-Tagged | +Inquiry |
| CENPB-740H | Recombinant Human CENPB Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPB-333HCL | Recombinant Human CENPB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPB Products
Required fields are marked with *
My Review for All CENPB Products
Required fields are marked with *
