Recombinant Human CENPC Protein, GST-Tagged
Cat.No. : | CENPC-1114H |
Product Overview : | Recombinant Human CENPC protein(NP_001349410.1)(598-943 aa), fused to GST-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 598-943 aa |
Description : | Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | EGSGGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDLVRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR |
Endotoxin : | Please contact the lab for more information. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | CENPC centromere protein C [ Homo sapiens (human) ] |
Official Symbol | CENPC |
Synonyms | CENP-C; CENPC; MIF2; hcp-4 |
Gene ID | 1060 |
mRNA Refseq | NM_001362481.2 |
Protein Refseq | NP_001349410.1 |
MIM | 117141 |
UniProt ID | Q03188 |
◆ Recombinant Proteins | ||
CENPC-6608C | Recombinant Chicken CENPC | +Inquiry |
CENPC-1113H | Recombinant Human CENPC Protein, GST-Tagged | +Inquiry |
CENPC-2824H | Recombinant Human CENPC protein(151-230 aa), C-His-tagged | +Inquiry |
CENPC-3319HF | Recombinant Full Length Human CENPC Protein, GST-tagged | +Inquiry |
CENPC-1114H | Recombinant Human CENPC Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPC Products
Required fields are marked with *
My Review for All CENPC Products
Required fields are marked with *