Recombinant Human CENPH, His-tagged
Cat.No. : | CENPH-27395TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 9-247 of Human CENPH with an N-terminal His Tag, approximately 42kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 9-247 a.a. |
Description : | Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRA QTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLE NEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSS VLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQL KQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNL QMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL EKNVDMM |
Sequence Similarities : | Belongs to the centromere protein H family. |
Gene Name | CENPH centromere protein H [ Homo sapiens ] |
Official Symbol | CENPH |
Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; |
Gene ID | 64946 |
mRNA Refseq | NM_022909 |
Protein Refseq | NP_075060 |
MIM | 605607 |
Uniprot ID | Q9H3R5 |
Chromosome Location | 5p15.2 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem; |
Function | kinetochore binding; protein binding; |
◆ Recombinant Proteins | ||
CENPH-6179C | Recombinant Chicken CENPH | +Inquiry |
CENPH-1578M | Recombinant Mouse CENPH Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPH-11095H | Recombinant Human CENPH, His-tagged | +Inquiry |
CENPH-26924TH | Recombinant Human CENPH, His-tagged | +Inquiry |
Cenph-326M | Recombinant Mouse Cenph Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *
0
Inquiry Basket