Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CENPH, His-tagged

Cat.No. : CENPH-27395TH
Product Overview : Recombinant fragment, corresponding to amino acids 9-247 of Human CENPH with an N-terminal His Tag, approximately 42kDa
  • Specification
  • Gene Information
  • Related Products
Description : Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRA QTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLE NEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSS VLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQL KQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNL QMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL EKNVDMM
Sequence Similarities : Belongs to the centromere protein H family.
Gene Name : CENPH centromere protein H [ Homo sapiens ]
Official Symbol : CENPH
Synonyms : CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1;
Gene ID : 64946
mRNA Refseq : NM_022909
Protein Refseq : NP_075060
MIM : 605607
Uniprot ID : Q9H3R5
Chromosome Location : 5p15.2
Pathway : Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem;
Function : kinetochore binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends