Recombinant Human CENPH, His-tagged
| Cat.No. : | CENPH-27395TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 9-247 of Human CENPH with an N-terminal His Tag, approximately 42kDa | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 9-247 a.a. | 
| Description : | Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:reconstitution with 102 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | DADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRA QTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLE NEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSS VLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQL KQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNL QMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL EKNVDMM | 
| Sequence Similarities : | Belongs to the centromere protein H family. | 
| Gene Name | CENPH centromere protein H [ Homo sapiens ] | 
| Official Symbol | CENPH | 
| Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; | 
| Gene ID | 64946 | 
| mRNA Refseq | NM_022909 | 
| Protein Refseq | NP_075060 | 
| MIM | 605607 | 
| Uniprot ID | Q9H3R5 | 
| Chromosome Location | 5p15.2 | 
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem; | 
| Function | kinetochore binding; protein binding; | 
| ◆ Recombinant Proteins | ||
| CENPH-1578M | Recombinant Mouse CENPH Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CENPH-1116H | Recombinant Human CENPH Protein, GST-Tagged | +Inquiry | 
| CENPH-11095H | Recombinant Human CENPH, His-tagged | +Inquiry | 
| CENPH-3644H | Recombinant Human CENPH, His-tagged | +Inquiry | 
| CENPH-27395TH | Recombinant Human CENPH, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            