Recombinant Human CEP112 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CEP112-159H
Product Overview : CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
Molecular Mass : 24.4 kDa
AA Sequence : MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CEP112 centrosomal protein 112 [ Homo sapiens (human) ]
Official Symbol CEP112
Synonyms CEP112; centrosomal protein 112; CCDC46; MACOCO; centrosomal protein of 112 kDa; centrosomal protein 112kDa; coiled-coil domain-containing protein 46
Gene ID 201134
mRNA Refseq NM_001037325
Protein Refseq NP_001032402
MIM 618980
UniProt ID Q8N8E3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEP112 Products

Required fields are marked with *

My Review for All CEP112 Products

Required fields are marked with *

0
cart-icon
0
compare icon