Recombinant Human CEP112 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CEP112-159H |
Product Overview : | CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CEP112 centrosomal protein 112 [ Homo sapiens (human) ] |
Official Symbol | CEP112 |
Synonyms | CEP112; centrosomal protein 112; CCDC46; MACOCO; centrosomal protein of 112 kDa; centrosomal protein 112kDa; coiled-coil domain-containing protein 46 |
Gene ID | 201134 |
mRNA Refseq | NM_001037325 |
Protein Refseq | NP_001032402 |
MIM | 618980 |
UniProt ID | Q8N8E3 |
◆ Recombinant Proteins | ||
CEP112-5436C | Recombinant Chicken CEP112 | +Inquiry |
Cep112-2007M | Recombinant Mouse Cep112 Protein, Myc/DDK-tagged | +Inquiry |
CEP112-1130H | Recombinant Human CEP112 Protein, GST-Tagged | +Inquiry |
CEP112-3154HF | Recombinant Full Length Human CEP112 Protein, GST-tagged | +Inquiry |
CEP112-159H | Recombinant Human CEP112 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP112 Products
Required fields are marked with *
My Review for All CEP112 Products
Required fields are marked with *