Recombinant Human CEP19 Protein, GST-Tagged
| Cat.No. : | CEP19-0027H |
| Product Overview : | Human C3orf34 full-length ORF (BAG36771.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. [provided by RefSeq, Apr 2014] |
| Molecular Mass : | 44.33 kDa |
| AA Sequence : | MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CEP19 centrosomal protein 19kDa [ Homo sapiens ] |
| Official Symbol | CEP19 |
| Synonyms | CEP19; centrosomal protein 19kDa; C3orf34, chromosome 3 open reading frame 34; centrosomal protein of 19 kDa; MGC14126; C3orf34; |
| Gene ID | 84984 |
| mRNA Refseq | NM_032898 |
| Protein Refseq | NP_116287 |
| MIM | 615586 |
| UniProt ID | Q96LK0 |
| ◆ Recombinant Proteins | ||
| CEP19-3303M | Recombinant Mouse CEP19 Protein | +Inquiry |
| CEP19-4843C | Recombinant Chicken CEP19 | +Inquiry |
| CEP19-4841C | Recombinant Chicken CEP19 | +Inquiry |
| CEP19-816R | Recombinant Rhesus monkey CEP19 Protein, His-tagged | +Inquiry |
| CEP19-3156HF | Recombinant Full Length Human CEP19 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEP19-8048HCL | Recombinant Human C3orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP19 Products
Required fields are marked with *
My Review for All CEP19 Products
Required fields are marked with *
