Recombinant Human CEP19 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CEP19-3696H |
Product Overview : | C3orf34 MS Standard C13 and N15-labeled recombinant protein (NP_116287) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CEP19 centrosomal protein 19kDa [ Homo sapiens (human) ] |
Official Symbol | CEP19 |
Synonyms | CEP19; centrosomal protein 19kDa; C3orf34, chromosome 3 open reading frame 34; centrosomal protein of 19 kDa; MGC14126; C3orf34; |
Gene ID | 84984 |
mRNA Refseq | NM_032898 |
Protein Refseq | NP_116287 |
MIM | 615586 |
UniProt ID | Q96LK0 |
◆ Recombinant Proteins | ||
CEP19-642R | Recombinant Rhesus Macaque CEP19 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEP19-3156HF | Recombinant Full Length Human CEP19 Protein, GST-tagged | +Inquiry |
CEP19-4842C | Recombinant Chicken CEP19 | +Inquiry |
CEP19-3696H | Recombinant Human CEP19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CEP19-3413Z | Recombinant Zebrafish CEP19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEP19-8048HCL | Recombinant Human C3orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP19 Products
Required fields are marked with *
My Review for All CEP19 Products
Required fields are marked with *