Recombinant Human CETN3 protein, GST-tagged

• Cat.No.: CETN3-2689H
• Product Overview: Recombinant Human CETN3 protein(O15182)(1-167aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-167aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.5 kDa
• AA Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ]
• Official Symbol: CETN3
• Synonyms: CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245
• Gene ID: 1070
• mRNA Refseq: NM_004365
• Protein Refseq: NP_004356
• MIM: 602907
• UniProt ID: O15182