Recombinant Human CETN3 protein, GST-tagged

Cat.No. : CETN3-2689H
Product Overview : Recombinant Human CETN3 protein(O15182)(1-167aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-167aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.5 kDa
AA Sequence : MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ]
Official Symbol CETN3
Synonyms CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245;
Gene ID 1070
mRNA Refseq NM_004365
Protein Refseq NP_004356
MIM 602907
UniProt ID O15182

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CETN3 Products

Required fields are marked with *

My Review for All CETN3 Products

Required fields are marked with *

0
cart-icon