Recombinant Human CETN3 protein, GST-tagged
Cat.No. : | CETN3-2689H |
Product Overview : | Recombinant Human CETN3 protein(O15182)(1-167aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-167aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ] |
Official Symbol | CETN3 |
Synonyms | CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245; |
Gene ID | 1070 |
mRNA Refseq | NM_004365 |
Protein Refseq | NP_004356 |
MIM | 602907 |
UniProt ID | O15182 |
◆ Recombinant Proteins | ||
CETN3-1608M | Recombinant Mouse CETN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN3-1158H | Recombinant Human CETN3 Protein, GST-Tagged | +Inquiry |
CETN3-0994H | Recombinant Human CETN3 Protein (Met1-Gly165), N-His tagged | +Inquiry |
CETN3-27956TH | Recombinant Human CETN3, His-tagged | +Inquiry |
CETN3-4395H | Recombinant Human CETN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN3-7560HCL | Recombinant Human CETN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CETN3 Products
Required fields are marked with *
My Review for All CETN3 Products
Required fields are marked with *