Recombinant Human CFAP65 Protein, GST-Tagged
Cat.No. : | CFAP65-0507H |
Product Overview : | Human CFAP65 full-length ORF (AAH31585.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene has putative coiled-coil domains and may be a transmembrane protein. The chicken ortholog of this gene is involved in the Rose-comb mutation, which is a large chromosome inversion, resulting in altered comb morphology and defects in sperm motility. [provided by RefSeq, Aug 2016] |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MLTQAPSSVVRSRNSRNHTVNSGGSCLSASTVAIPAINDSSAAMSACSTISAQPASSMDTQMHSPKKQERVNKRVIWGIEVAEELHWKGWELGKETTRNLVLKNRSLKLQKMKYRYQYKGSRTQCHSLEPRKQALFKTKQNKQKKPLTCHIKASECLKYMQYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFAP65 cilia and flagella associated protein 65 [ Homo sapiens (human) ] |
Official Symbol | CFAP65 |
Synonyms | CFAP65; cilia and flagella associated protein 65; CCDC108; coiled-coil domain containing 108; coiled-coil domain-containing protein 108; DKFZp434O0527; MGC35338; |
Gene ID | 255101 |
mRNA Refseq | NM_152389 |
Protein Refseq | NP_689602 |
MIM | 614270 |
UniProt ID | Q6ZU64 |
◆ Recombinant Proteins | ||
CFAP65-0507H | Recombinant Human CFAP65 Protein, GST-Tagged | +Inquiry |
CFAP65-2818HF | Recombinant Full Length Human CFAP65 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP65 Products
Required fields are marked with *
My Review for All CFAP65 Products
Required fields are marked with *