Recombinant Human CFAP65 Protein, GST-Tagged

Cat.No. : CFAP65-0507H
Product Overview : Human CFAP65 full-length ORF (AAH31585.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene has putative coiled-coil domains and may be a transmembrane protein. The chicken ortholog of this gene is involved in the Rose-comb mutation, which is a large chromosome inversion, resulting in altered comb morphology and defects in sperm motility. [provided by RefSeq, Aug 2016]
Molecular Mass : 44.9 kDa
AA Sequence : MLTQAPSSVVRSRNSRNHTVNSGGSCLSASTVAIPAINDSSAAMSACSTISAQPASSMDTQMHSPKKQERVNKRVIWGIEVAEELHWKGWELGKETTRNLVLKNRSLKLQKMKYRYQYKGSRTQCHSLEPRKQALFKTKQNKQKKPLTCHIKASECLKYMQYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFAP65 cilia and flagella associated protein 65 [ Homo sapiens (human) ]
Official Symbol CFAP65
Synonyms CFAP65; cilia and flagella associated protein 65; CCDC108; coiled-coil domain containing 108; coiled-coil domain-containing protein 108; DKFZp434O0527; MGC35338;
Gene ID 255101
mRNA Refseq NM_152389
Protein Refseq NP_689602
MIM 614270
UniProt ID Q6ZU64

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFAP65 Products

Required fields are marked with *

My Review for All CFAP65 Products

Required fields are marked with *

0
cart-icon
0
compare icon