Recombinant Human CFI protein(239-316aa), His-GST&Myc-tagged
| Cat.No. : | CFI-2741H |
| Product Overview : | Recombinant Human CFI protein(P05156)(239-316aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 239-316aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | KACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERR |
| Gene Name | CFI complement factor I [ Homo sapiens ] |
| Official Symbol | CFI |
| Synonyms | CFI; complement factor I; I factor (complement) , IF; C3b INA; C3b inactivator; FI; KAF; Konglutinogen activating factor; C3b-inactivator; C3B/C4B inactivator; complement component I; light chain of factor I; Konglutinogen-activating factor; complement factor I heavy chain; complement control protein factor I; IF; AHUS3; C3BINA; C3b-INA; |
| Gene ID | 3426 |
| mRNA Refseq | NM_000204 |
| Protein Refseq | NP_000195 |
| MIM | 217030 |
| UniProt ID | P05156 |
| ◆ Recombinant Proteins | ||
| Cfi-2211R | Recombinant Rat Cfi protein, His&Myc-tagged | +Inquiry |
| CFI-1355R | Recombinant Rat CFI Protein | +Inquiry |
| CFI-2054H | Recombinant Human CFI protein, His & GST-tagged | +Inquiry |
| CFI-1531HFL | Recombinant Full Length Human CFI Protein, C-Flag-tagged | +Inquiry |
| CFI-1013R | Recombinant Rat CFI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CFI-105H | Active Native Human Factor I | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFI-7556HCL | Recombinant Human CFI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFI Products
Required fields are marked with *
My Review for All CFI Products
Required fields are marked with *
